SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mkka2 (5mkk A:337-600)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (126 species)
    not a true protein
  7. 2114809Species Thermus thermophilus [TaxId:262724] [187453] (13 PDB entries)
  8. 2285356Domain d5mkka2: 5mkk A:337-600 [328657]
    Other proteins in same PDB: d5mkka1, d5mkka3
    automated match to d4a82a2
    complexed with so4

Details for d5mkka2

PDB Entry: 5mkk (more details), 2.7 Å

PDB Description: crystal structure of the heterodimeric abc transporter tmrab, a homolog of the antigen translocation complex tap
PDB Compounds: (A:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOPe Domain Sequences for d5mkka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mkka2 c.37.1.0 (A:337-600) automated matches {Thermus thermophilus [TaxId: 262724]}
lkdpedptpirgfrgevefrdvwlaytpkgveptekdwvlkgvsfrvrpgekvalvgatg
agktsvvsliarfydpqrgcvfldgvdvrryrqeelrrhvgivlqepflfsgtvldnlrl
fdpsvpperveevarflgahefilrlpkgyqtvlgergaglstgekqllalvrallaspd
illildeatasvdsetekrlqealykamegrtsliiahrlstirhvdrilvfrkgrlvee
gsheellakggyyaalyrlqfqea

SCOPe Domain Coordinates for d5mkka2:

Click to download the PDB-style file with coordinates for d5mkka2.
(The format of our PDB-style files is described here.)

Timeline for d5mkka2:

  • d5mkka2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19