Lineage for d5mkka2 (5mkk A:337-600)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (136 species)
    not a true protein
  7. 2452969Species Thermus thermophilus [TaxId:262724] [187453] (13 PDB entries)
  8. 2452993Domain d5mkka2: 5mkk A:337-600 [328657]
    Other proteins in same PDB: d5mkka1, d5mkka3
    automated match to d4a82a2
    complexed with so4

Details for d5mkka2

PDB Entry: 5mkk (more details), 2.7 Å

PDB Description: crystal structure of the heterodimeric abc transporter tmrab, a homolog of the antigen translocation complex tap
PDB Compounds: (A:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOPe Domain Sequences for d5mkka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mkka2 c.37.1.0 (A:337-600) automated matches {Thermus thermophilus [TaxId: 262724]}
lkdpedptpirgfrgevefrdvwlaytpkgveptekdwvlkgvsfrvrpgekvalvgatg
agktsvvsliarfydpqrgcvfldgvdvrryrqeelrrhvgivlqepflfsgtvldnlrl
fdpsvpperveevarflgahefilrlpkgyqtvlgergaglstgekqllalvrallaspd
illildeatasvdsetekrlqealykamegrtsliiahrlstirhvdrilvfrkgrlvee
gsheellakggyyaalyrlqfqea

SCOPe Domain Coordinates for d5mkka2:

Click to download the PDB-style file with coordinates for d5mkka2.
(The format of our PDB-style files is described here.)

Timeline for d5mkka2: