![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
![]() | Protein automated matches [190123] (134 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:262724] [187453] (13 PDB entries) |
![]() | Domain d5mkka2: 5mkk A:337-600 [328657] Other proteins in same PDB: d5mkka1, d5mkka3 automated match to d4a82a2 complexed with so4 |
PDB Entry: 5mkk (more details), 2.7 Å
SCOPe Domain Sequences for d5mkka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mkka2 c.37.1.0 (A:337-600) automated matches {Thermus thermophilus [TaxId: 262724]} lkdpedptpirgfrgevefrdvwlaytpkgveptekdwvlkgvsfrvrpgekvalvgatg agktsvvsliarfydpqrgcvfldgvdvrryrqeelrrhvgivlqepflfsgtvldnlrl fdpsvpperveevarflgahefilrlpkgyqtvlgergaglstgekqllalvrallaspd illildeatasvdsetekrlqealykamegrtsliiahrlstirhvdrilvfrkgrlvee gsheellakggyyaalyrlqfqea
Timeline for d5mkka2: