Lineage for d5mkka1 (5mkk A:11-336)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580483Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 2580484Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families) (S)
    automatically mapped to Pfam PF00664
  5. 2580515Family f.37.1.0: automated matches [328653] (1 protein)
    not a true family
  6. 2580516Protein automated matches [328654] (3 species)
    not a true protein
  7. 2580522Species Thermus thermophilus [TaxId:262724] [328655] (1 PDB entry)
  8. 2580523Domain d5mkka1: 5mkk A:11-336 [328656]
    Other proteins in same PDB: d5mkka2, d5mkka3
    automated match to d4a82a1
    complexed with so4

Details for d5mkka1

PDB Entry: 5mkk (more details), 2.7 Å

PDB Description: crystal structure of the heterodimeric abc transporter tmrab, a homolog of the antigen translocation complex tap
PDB Compounds: (A:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOPe Domain Sequences for d5mkka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mkka1 f.37.1.0 (A:11-336) automated matches {Thermus thermophilus [TaxId: 262724]}
dralfarilryvwpyrlqvvlallfllvvtlaaaatplffkwaidlalvpteprplaerf
hlllwislgflavravhfaatygetyliqwvgqrvlfdlrsdlfaklmrlhpgfydrnpv
grlmtrvtsdvdainqfitgglvgviadlftlvgllgfmlflspkltlvvllvapvllav
ttwvrlgmrsayremrlrlarvnaalqenlsgvetiqlfvkerereekfdrlnrdlfraw
veiirwfalffpvvgflgdfavaslvyygggevvrgavslgllvafvdytrqlfqplqdl
sdkfnlfqgamasaerifgvldteee

SCOPe Domain Coordinates for d5mkka1:

Click to download the PDB-style file with coordinates for d5mkka1.
(The format of our PDB-style files is described here.)

Timeline for d5mkka1: