SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mkka1 (5mkk A:11-336)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2228434Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 2228435Superfamily f.37.1: ABC transporter transmembrane region [90123] (2 families) (S)
    automatically mapped to Pfam PF00664
  5. 2285352Family f.37.1.0: automated matches [328653] (1 protein)
    not a true family
  6. 2285353Protein automated matches [328654] (1 species)
    not a true protein
  7. 2285354Species Thermus thermophilus [TaxId:262724] [328655] (1 PDB entry)
  8. 2285355Domain d5mkka1: 5mkk A:11-336 [328656]
    Other proteins in same PDB: d5mkka2, d5mkka3
    automated match to d4a82a1
    complexed with so4

Details for d5mkka1

PDB Entry: 5mkk (more details), 2.7 Å

PDB Description: crystal structure of the heterodimeric abc transporter tmrab, a homolog of the antigen translocation complex tap
PDB Compounds: (A:) Multidrug resistance ABC transporter ATP-binding and permease protein

SCOPe Domain Sequences for d5mkka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mkka1 f.37.1.0 (A:11-336) automated matches {Thermus thermophilus [TaxId: 262724]}
dralfarilryvwpyrlqvvlallfllvvtlaaaatplffkwaidlalvpteprplaerf
hlllwislgflavravhfaatygetyliqwvgqrvlfdlrsdlfaklmrlhpgfydrnpv
grlmtrvtsdvdainqfitgglvgviadlftlvgllgfmlflspkltlvvllvapvllav
ttwvrlgmrsayremrlrlarvnaalqenlsgvetiqlfvkerereekfdrlnrdlfraw
veiirwfalffpvvgflgdfavaslvyygggevvrgavslgllvafvdytrqlfqplqdl
sdkfnlfqgamasaerifgvldteee

SCOPe Domain Coordinates for d5mkka1:

Click to download the PDB-style file with coordinates for d5mkka1.
(The format of our PDB-style files is described here.)

Timeline for d5mkka1:

  • d5mkka1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19