Lineage for d5hd8d2 (5hd8 D:107-211)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (491 PDB entries)
  8. 2285345Domain d5hd8d2: 5hd8 D:107-211 [328646]
    Other proteins in same PDB: d5hd8a_, d5hd8b_, d5hd8d1, d5hd8f1
    automated match to d1ikfl2
    complexed with cl

Details for d5hd8d2

PDB Entry: 5hd8 (more details), 3.15 Å

PDB Description: crystal structure of disulfide cross-linked d417c clc-ec1
PDB Compounds: (D:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d5hd8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hd8d2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d5hd8d2:

Click to download the PDB-style file with coordinates for d5hd8d2.
(The format of our PDB-style files is described here.)

Timeline for d5hd8d2:

  • d5hd8d2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19