SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hd8d2 (5hd8 D:107-211)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (462 PDB entries)
  8. 2285345Domain d5hd8d2: 5hd8 D:107-211 [328646]
    Other proteins in same PDB: d5hd8a_, d5hd8b_, d5hd8d1, d5hd8f1
    automated match to d1ikfl2
    complexed with cl

Details for d5hd8d2

PDB Entry: 5hd8 (more details), 3.15 Å

PDB Description: crystal structure of disulfide cross-linked d417c clc-ec1
PDB Compounds: (D:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d5hd8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hd8d2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d5hd8d2:

Click to download the PDB-style file with coordinates for d5hd8d2.
(The format of our PDB-style files is described here.)

Timeline for d5hd8d2:

  • d5hd8d2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19