SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hd8d1 (5hd8 D:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (546 PDB entries)
  8. 2285344Domain d5hd8d1: 5hd8 D:1-106 [328645]
    Other proteins in same PDB: d5hd8a_, d5hd8b_, d5hd8d2, d5hd8f2
    automated match to d1ikfl1
    complexed with cl

Details for d5hd8d1

PDB Entry: 5hd8 (more details), 3.15 Å

PDB Description: crystal structure of disulfide cross-linked d417c clc-ec1
PDB Compounds: (D:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d5hd8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hd8d1 b.1.1.0 (D:1-106) automated matches {Mus musculus [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d5hd8d1:

Click to download the PDB-style file with coordinates for d5hd8d1.
(The format of our PDB-style files is described here.)

Timeline for d5hd8d1:

  • d5hd8d1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19