SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hh4a_ (5hh4 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205847Protein automated matches [190079] (9 species)
    not a true protein
  7. 2205927Species Serratia marcescens [TaxId:615] [186800] (5 PDB entries)
  8. 2285341Domain d5hh4a_: 5hh4 A: [328642]
    Other proteins in same PDB: d5hh4b2
    automated match to d1jjeb_
    complexed with 60m, cl, edo, zn

Details for d5hh4a_

PDB Entry: 5hh4 (more details), 2 Å

PDB Description: crystal structure of metallo-beta-lactamase imp-1 in complex with a phosphonate-based inhibitor
PDB Compounds: (A:) beta-lactamase imp-1

SCOPe Domain Sequences for d5hh4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hh4a_ d.157.1.1 (A:) automated matches {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglnes

SCOPe Domain Coordinates for d5hh4a_:

Click to download the PDB-style file with coordinates for d5hh4a_.
(The format of our PDB-style files is described here.)

Timeline for d5hh4a_:

  • d5hh4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19