Lineage for d5ldmb_ (5ldm B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178385Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2178386Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2178448Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2178449Protein automated matches [190796] (6 species)
    not a true protein
  7. 2285265Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries)
  8. 2285339Domain d5ldmb_: 5ldm B: [328640]
    automated match to d4qakb_
    complexed with 2am, cl

Details for d5ldmb_

PDB Entry: 5ldm (more details), 2.46 Å

PDB Description: crystal structure of e.coli ligt complexed with 2'-amp
PDB Compounds: (B:) RNA 2',3'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5ldmb_:

Sequence, based on SEQRES records: (download)

>d5ldmb_ d.61.1.0 (B:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrp
fhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Sequence, based on observed residues (ATOM records): (download)

>d5ldmb_ d.61.1.0 (B:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfpfhph
itllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

SCOPe Domain Coordinates for d5ldmb_:

Click to download the PDB-style file with coordinates for d5ldmb_.
(The format of our PDB-style files is described here.)

Timeline for d5ldmb_:

  • d5ldmb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19