SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mesa_ (5mes A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2223824Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2223896Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2223897Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 protein domains)
    Pfam PF00452
  6. 2224027Protein automated matches [190236] (4 species)
    not a true protein
  7. 2224028Species Human (Homo sapiens) [TaxId:9606] [188722] (46 PDB entries)
  8. 2285338Domain d5mesa_: 5mes A: [328639]
    Other proteins in same PDB: d5mesl1, d5mesl2
    automated match to d2kbwa_
    complexed with 7lt

Details for d5mesa_

PDB Entry: 5mes (more details), 2.24 Å

PDB Description: mcl1 fab complex in complex with compound 29
PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d5mesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mesa_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

SCOPe Domain Coordinates for d5mesa_:

Click to download the PDB-style file with coordinates for d5mesa_.
(The format of our PDB-style files is described here.)

Timeline for d5mesa_:

  • d5mesa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19