Lineage for d5mesa_ (5mes A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021303Protein EAT/MCL-1 (Myeloid cell leukemia sequence 1) [118212] (2 species)
  7. 3021304Species Human (Homo sapiens) [TaxId:9606] [188549] (62 PDB entries)
  8. 3021393Domain d5mesa_: 5mes A: [328639]
    Other proteins in same PDB: d5mesh_, d5mesl1, d5mesl2
    automated match to d2kbwa_
    complexed with 7lt

Details for d5mesa_

PDB Entry: 5mes (more details), 2.24 Å

PDB Description: mcl1 fab complex in complex with compound 29
PDB Compounds: (A:) Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Induced myeloid leukemia cell differentiation protein Mcl-1

SCOPe Domain Sequences for d5mesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mesa_ f.1.4.1 (A:) EAT/MCL-1 (Myeloid cell leukemia sequence 1) {Human (Homo sapiens) [TaxId: 9606]}
ddlyrqsleiisrylreqatgskdskplgeagaagrraletlrrvgdgvqrnhetafqgm
lrkldikneddvkslsrvmihvfsdgvtnwgrivtlisfgafvakhlktinqesciepla
esitdvlvrtkrdwlvkqrgwdgfveffhve

SCOPe Domain Coordinates for d5mesa_:

Click to download the PDB-style file with coordinates for d5mesa_.
(The format of our PDB-style files is described here.)

Timeline for d5mesa_: