SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h1ya_ (5h1y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (122 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (117 PDB entries)
  8. 2285336Domain d5h1ya_: 5h1y A: [328637]
    automated match to d4a4da_
    protein/DNA complex; complexed with mg, so4

Details for d5h1ya_

PDB Entry: 5h1y (more details), 2.26 Å

PDB Description: crystal structure of the ddx41 dead domain in complex with so42- and mg2+
PDB Compounds: (A:) Probable ATP-dependent RNA helicase DDX41

SCOPe Domain Sequences for d5h1ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h1ya_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eerhervrkkyhilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgiptil
sgrdmigiaftgsgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqthgi
leyycrllqedsspllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmvsld
icrylaldeadrmidmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkpvti
nv

SCOPe Domain Coordinates for d5h1ya_:

Click to download the PDB-style file with coordinates for d5h1ya_.
(The format of our PDB-style files is described here.)

Timeline for d5h1ya_:

  • d5h1ya_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19