SCOPe 2.06: Domain d5hk4b2: 5hk4 B:139-455

Lineage for d5hk4b2 (5hk4 B:139-455)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (9 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [327791] (7 PDB entries)

8. Domain d5hk4b2: 5hk4 B:139-455 [328632]
   Other proteins in same PDB: d5hk4a1, d5hk4b1, d5hk4c1, d5hk4d1, d5hk4e1, d5hk4f1
   automated match to d4lf2a2
   complexed with cap, mg; mutant

Details for d5hk4b2

PDB Entry: 5hk4, 2.15 Å

PDB Description: structure function studies of r. palustris rubisco (a47v-m331a mutant)

PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hk4b2:

Sequence; same for both SEQRES and ATOM records:

>d5hk4b2 c.1.14.1 (B:139-455) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwrak

Timeline for d5hk4b2:

• d5hk4b2 is new in SCOPe 2.06-stable
  
• d5hk4b2 appears in SCOPe 2.07
  
• d5hk4b2 appears in the current release, SCOPe 2.08