Lineage for d5lnua_ (5lnu A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2280329Species Arabidopsis thaliana [TaxId:3702] [323630] (8 PDB entries)
  8. 2285326Domain d5lnua_: 5lnu A: [328627]
    automated match to d3fema_
    complexed with kik, po4, so4

Details for d5lnua_

PDB Entry: 5lnu (more details), 1.73 Å

PDB Description: crystal structure of arabidopsis thaliana pdx1-i320 complex
PDB Compounds: (A:) Pyridoxal 5'-phosphate synthase subunit PDX1.3

SCOPe Domain Sequences for d5lnua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lnua_ c.1.2.0 (A:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
arraraivqavthysdpemlvevscglgeamvginln

SCOPe Domain Coordinates for d5lnua_:

Click to download the PDB-style file with coordinates for d5lnua_.
(The format of our PDB-style files is described here.)

Timeline for d5lnua_:

  • d5lnua_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19