Lineage for d5h3aa_ (5h3a A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190102Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2190103Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2190104Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 protein domains)
  6. 2190399Protein automated matches [190469] (15 species)
    not a true protein
  7. 2285170Species Human herpesvirus 8 [TaxId:37296] [328471] (3 PDB entries)
  8. 2285323Domain d5h3aa_: 5h3a A: [328624]
    automated match to d1hvya_
    complexed with d16, ump

Details for d5h3aa_

PDB Entry: 5h3a (more details), 2.4 Å

PDB Description: structural analysis of kshv thymidylate synthase
PDB Compounds: (A:) orf70

SCOPe Domain Sequences for d5h3aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h3aa_ d.117.1.1 (A:) automated matches {Human herpesvirus 8 [TaxId: 37296]}
pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq
ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay
vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg
elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr
lqltrtprpfprleilrsvssmeeftpddfrlvdycphpti

SCOPe Domain Coordinates for d5h3aa_:

Click to download the PDB-style file with coordinates for d5h3aa_.
(The format of our PDB-style files is described here.)

Timeline for d5h3aa_:

  • d5h3aa_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19