Lineage for d5gxga_ (5gxg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2331248Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2331249Species Pseudomonas putida [TaxId:303] [48267] (118 PDB entries)
    Uniprot P00183
  8. 2331330Domain d5gxga_: 5gxg A: [328622]
    Other proteins in same PDB: d5gxgb_
    automated match to d4kkyx_
    complexed with dtt, fes, hem, so4

Details for d5gxga_

PDB Entry: 5gxg (more details), 1.7 Å

PDB Description: high-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d5gxga_:

Sequence, based on SEQRES records: (download)

>d5gxga_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdclen
ciqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

Sequence, based on observed residues (ATOM records): (download)

>d5gxga_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreydfiptsmdppeqrqfralanqvvgmpvvdclenciqe
lacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtf
aeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtv
vnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlk
kgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivtlke
wltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d5gxga_:

Click to download the PDB-style file with coordinates for d5gxga_.
(The format of our PDB-style files is described here.)

Timeline for d5gxga_: