SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gxga_ (5gxg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005501Species Pseudomonas putida [TaxId:303] [186787] (7 PDB entries)
  8. 2285321Domain d5gxga_: 5gxg A: [328622]
    Other proteins in same PDB: d5gxgb_
    automated match to d4kkyx_
    complexed with dtt, fes, hem, so4

Details for d5gxga_

PDB Entry: 5gxg (more details), 1.7 Å

PDB Description: high-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d5gxga_:

Sequence, based on SEQRES records: (download)

>d5gxga_ a.104.1.1 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdclen
ciqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

Sequence, based on observed residues (ATOM records): (download)

>d5gxga_ a.104.1.1 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreydfiptsmdppeqrqfralanqvvgmpvvdclenciqe
lacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtf
aeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtv
vnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhgvqlk
kgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiivtlke
wltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d5gxga_:

Click to download the PDB-style file with coordinates for d5gxga_.
(The format of our PDB-style files is described here.)

Timeline for d5gxga_:

  • d5gxga_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19