SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hkwc3 (5hkw C:264-349)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184972Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2184973Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2184974Family d.93.1.1: SH2 domain [55551] (35 protein domains)
    Pfam PF00017
  6. 2185081Protein Cbl [55587] (1 species)
  7. 2185082Species Human (Homo sapiens) [TaxId:9606] [55588] (11 PDB entries)
  8. 2285319Domain d5hkwc3: 5hkw C:264-349 [328620]
    Other proteins in same PDB: d5hkwa1, d5hkwa2, d5hkwb1, d5hkwb2, d5hkwc1, d5hkwc2
    automated match to d1b47a3
    complexed with na

Details for d5hkwc3

PDB Entry: 5hkw (more details), 2.25 Å

PDB Description: crystal structure of apo c-cbl tkbd refined to 2.25 a resolution
PDB Compounds: (C:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d5hkwc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkwc3 d.93.1.1 (C:264-349) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdl

SCOPe Domain Coordinates for d5hkwc3:

Click to download the PDB-style file with coordinates for d5hkwc3.
(The format of our PDB-style files is described here.)

Timeline for d5hkwc3:

  • d5hkwc3 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19