Lineage for d5hkwc3 (5hkw C:264-349)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2184972Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2184973Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2184974Family d.93.1.1: SH2 domain [55551] (35 protein domains)
    Pfam PF00017
  6. 2185081Protein Cbl [55587] (1 species)
  7. 2185082Species Human (Homo sapiens) [TaxId:9606] [55588] (11 PDB entries)
  8. 2285319Domain d5hkwc3: 5hkw C:264-349 [328620]
    Other proteins in same PDB: d5hkwa1, d5hkwa2, d5hkwb1, d5hkwb2, d5hkwc1, d5hkwc2
    automated match to d1b47a3
    complexed with na

Details for d5hkwc3

PDB Entry: 5hkw (more details), 2.25 Å

PDB Description: crystal structure of apo c-cbl tkbd refined to 2.25 a resolution
PDB Compounds: (C:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d5hkwc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkwc3 d.93.1.1 (C:264-349) Cbl {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp
lfqalidgfregfylfpdgrnqnpdl

SCOPe Domain Coordinates for d5hkwc3:

Click to download the PDB-style file with coordinates for d5hkwc3.
(The format of our PDB-style files is described here.)

Timeline for d5hkwc3:

  • d5hkwc3 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19