SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hkwc2 (5hkw C:178-263)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1995442Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 protein domains)
  6. 1995446Protein Cbl [47561] (1 species)
  7. 1995447Species Human (Homo sapiens) [TaxId:9606] [47562] (11 PDB entries)
  8. 2285318Domain d5hkwc2: 5hkw C:178-263 [328619]
    Other proteins in same PDB: d5hkwa1, d5hkwa3, d5hkwb1, d5hkwb3, d5hkwc1, d5hkwc3
    automated match to d3buxb1
    complexed with na

Details for d5hkwc2

PDB Entry: 5hkw (more details), 2.25 Å

PDB Description: crystal structure of apo c-cbl tkbd refined to 2.25 a resolution
PDB Compounds: (C:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d5hkwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkwc2 a.39.1.7 (C:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOPe Domain Coordinates for d5hkwc2:

Click to download the PDB-style file with coordinates for d5hkwc2.
(The format of our PDB-style files is described here.)

Timeline for d5hkwc2:

  • d5hkwc2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19