SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hkwc1 (5hkw C:48-177)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997956Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 1997957Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) (S)
    automatically mapped to Pfam PF02262
  5. 1997958Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein)
  6. 1997959Protein N-terminal domain of cbl (N-cbl) [47670] (1 species)
  7. 1997960Species Human (Homo sapiens) [TaxId:9606] [47671] (11 PDB entries)
  8. 2285317Domain d5hkwc1: 5hkw C:48-177 [328618]
    Other proteins in same PDB: d5hkwa2, d5hkwa3, d5hkwb2, d5hkwb3, d5hkwc2, d5hkwc3
    automated match to d2cbla2
    complexed with na

Details for d5hkwc1

PDB Entry: 5hkw (more details), 2.25 Å

PDB Description: crystal structure of apo c-cbl tkbd refined to 2.25 a resolution
PDB Compounds: (C:) E3 ubiquitin-protein ligase CBL

SCOPe Domain Sequences for d5hkwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hkwc1 a.48.1.1 (C:48-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]}
pgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkme
tlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelkg
ifpsglfqgd

SCOPe Domain Coordinates for d5hkwc1:

Click to download the PDB-style file with coordinates for d5hkwc1.
(The format of our PDB-style files is described here.)

Timeline for d5hkwc1:

  • d5hkwc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19