SCOP 1.63: Domain d7gssb2: 7gss B:1-76

Lineage for d7gssb2 (7gss B:1-76)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class pi GST [81358] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (33 PDB entries)

8. Domain d7gssb2: 7gss B:1-76 [32861]
   Other proteins in same PDB: d7gssa1, d7gssb1
   complexed with gtt, mes

Details for d7gssb2

PDB Entry: 7gss, 2.2 Å

PDB Description: Human glutathione S-transferase P1-1, complex with glutathione

SCOP Domain Sequences for d7gssb2:

Sequence; same for both SEQRES and ATOM records:

>d7gssb2 c.47.1.5 (B:1-76) Class pi GST {Human (Homo sapiens)}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d7gssb2:

• d7gssb2 first appeared (with stable ids) in SCOP 1.55
  
• d7gssb2 appears in SCOP 1.61
  
• d7gssb2 appears in SCOP 1.65
  
• d7gssb2 appears in the current release, SCOPe 2.08