Lineage for d5ljka_ (5ljk A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063324Protein automated matches [190295] (6 species)
    not a true protein
  7. 2063340Species Human (Homo sapiens) [TaxId:9606] [187133] (57 PDB entries)
  8. 2285301Domain d5ljka_: 5ljk A: [328602]
    automated match to d1kgla_
    complexed with na

Details for d5ljka_

PDB Entry: 5ljk (more details), 1.7 Å

PDB Description: crystal structure of human apo crbp1
PDB Compounds: (A:) Retinol-binding protein 1

SCOPe Domain Sequences for d5ljka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljka_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvdftgywkmlvnenfeeylraldvnvalrkianllkpdkeivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
vegvvckqvfkkvq

SCOPe Domain Coordinates for d5ljka_:

Click to download the PDB-style file with coordinates for d5ljka_.
(The format of our PDB-style files is described here.)

Timeline for d5ljka_:

  • d5ljka_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19