SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ljha_ (5ljh A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063324Protein automated matches [190295] (6 species)
    not a true protein
  7. 2063340Species Human (Homo sapiens) [TaxId:9606] [187133] (54 PDB entries)
  8. 2285300Domain d5ljha_: 5ljh A: [328601]
    automated match to d1kgla_
    complexed with na; mutant

Details for d5ljha_

PDB Entry: 5ljh (more details), 1.52 Å

PDB Description: crystal structure of human apo crbp1/k40l mutant
PDB Compounds: (A:) Retinol-binding protein 1

SCOPe Domain Sequences for d5ljha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljha_ b.60.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvdftgywkmlvnenfeeylraldvnvalrkianllkpdleivqdgdhmiirtlstfrny
imdfqvgkefeedltgiddrkcmttvswdgdklqcvqkgekegrgwtqwiegdelhlemr
vegvvckqvfkkvq

SCOPe Domain Coordinates for d5ljha_:

Click to download the PDB-style file with coordinates for d5ljha_.
(The format of our PDB-style files is described here.)

Timeline for d5ljha_:

  • d5ljha_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19