Lineage for d5hk3a_ (5hk3 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2046974Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2285221Family b.34.6.0: automated matches [328522] (1 protein)
    not a true family
  6. 2285222Protein automated matches [328523] (1 species)
    not a true protein
  7. 2285223Species Mycobacterium tuberculosis [TaxId:83332] [328524] (3 PDB entries)
  8. 2285299Domain d5hk3a_: 5hk3 A: [328600]
    automated match to d4of1a_
    protein/DNA complex; mutant

Details for d5hk3a_

PDB Entry: 5hk3 (more details), 1.56 Å

PDB Description: crystal structure of m. tuberculosis mazf-mt3 t52d-f62d mutant in complex with dna
PDB Compounds: (A:) Endoribonuclease MazF6

SCOPe Domain Sequences for d5hk3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hk3a_ b.34.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
visraeiywadlgppsgsqpakrrpvlviqsdpynasrlatviaavitsndalaampgnv
dlpatttrlprdsvvnvtaivtlnktdltdrvgevpaslmhevdrglrrvldl

SCOPe Domain Coordinates for d5hk3a_:

Click to download the PDB-style file with coordinates for d5hk3a_.
(The format of our PDB-style files is described here.)

Timeline for d5hk3a_:

  • d5hk3a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19

View in 3D
Domains from other chains:
(mouse over for more information)
d5hk3b_