SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hd8a_ (5hd8 A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225962Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2225963Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2225964Family f.20.1.1: Clc chloride channel [69912] (2 protein domains)
    duplication: consist of two similar structural parts
  6. 2226012Protein automated matches [226846] (4 species)
    not a true protein
  7. 2226040Species Escherichia coli [TaxId:216592] [255982] (2 PDB entries)
  8. 2285298Domain d5hd8a_: 5hd8 A: [328599]
    Other proteins in same PDB: d5hd8d1, d5hd8d2, d5hd8f1, d5hd8f2
    automated match to d3nmoa_
    complexed with cl

Details for d5hd8a_

PDB Entry: 5hd8 (more details), 3.15 Å

PDB Description: crystal structure of disulfide cross-linked d417c clc-ec1
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d5hd8a_:

Sequence, based on SEQRES records: (download)

>d5hd8a_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 216592]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatlla
qftggkplysailartlakqea

Sequence, based on observed residues (ATOM records): (download)

>d5hd8a_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 216592]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhlsdaplntlwlylilgiifgif
gpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggfnlipiata
gnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvavelfpqyhle
agtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatllaqftggkply
sailartlakqea

SCOPe Domain Coordinates for d5hd8a_:

Click to download the PDB-style file with coordinates for d5hd8a_.
(The format of our PDB-style files is described here.)

Timeline for d5hd8a_:

  • d5hd8a_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19