Lineage for d5hd8a_ (5hd8 A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577647Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2577648Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2577649Family f.20.1.1: Clc chloride channel [69912] (2 protein domains)
    duplication: consist of two similar structural parts
  6. 2577697Protein automated matches [226846] (3 species)
    not a true protein
  7. 2577727Species Escherichia coli [TaxId:216592] [255982] (2 PDB entries)
  8. 2577729Domain d5hd8a_: 5hd8 A: [328599]
    Other proteins in same PDB: d5hd8d1, d5hd8d2, d5hd8f1, d5hd8f2
    automated match to d3nmoa_
    complexed with cl

Details for d5hd8a_

PDB Entry: 5hd8 (more details), 3.15 Å

PDB Description: crystal structure of disulfide cross-linked d417c clc-ec1
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d5hd8a_:

Sequence, based on SEQRES records: (download)

>d5hd8a_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 216592]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatlla
qftggkplysailartlakqea

Sequence, based on observed residues (ATOM records): (download)

>d5hd8a_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 216592]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhlsdaplntlwlylilgiifgif
gpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggfnlipiata
gnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvavelfpqyhle
agtfaiagmgallaasirapltgiilvlemtcnyqlilpmiitglgatllaqftggkply
sailartlakqea

SCOPe Domain Coordinates for d5hd8a_:

Click to download the PDB-style file with coordinates for d5hd8a_.
(The format of our PDB-style files is described here.)

Timeline for d5hd8a_: