Lineage for d5fyfb_ (5fyf B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (61 species)
    not a true protein
  7. 2285155Species Marinobacter hydrocarbonoclasticus [TaxId:2743] [328456] (2 PDB entries)
  8. 2285292Domain d5fyfb_: 5fyf B: [328593]
    automated match to d4pwva_
    complexed with edo, hem

Details for d5fyfb_

PDB Entry: 5fyf (more details), 2.04 Å

PDB Description: structure of cyp153a from marinobacter aquaeolei
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d5fyfb_:

Sequence, based on SEQRES records: (download)

>d5fyfb_ a.104.1.0 (B:) automated matches {Marinobacter hydrocarbonoclasticus [TaxId: 2743]}
fvetpipdvntlaledidvsnpflyrqgqwrayfkrlrdeapvhyqknspfgpfwsvtrf
edilfvdkshdlfsaepqiilgdppeglsvemfiamdppkhdvqrssvqgvvapknlkem
eglirsrtgdvldslptdkpfnwvpavskeltgrmlatlldfpyeerhklvewsdrmaga
asatggefadenamfddaadmarsfsrlwrdkearraageepgfdlisllqsnketkdli
nrpmefignltllivggndttrnsmsgglvamnefprefeklkakpelipnmvseiirwq
tplaymrriakqdvelggqtikkgdrvvmwyasgnrderkfdnpdqfiidrkdarnhmsf
gygvhrcmgnrlaelqlrilweeilkrfdnievveepervqsnfvrgysrlmvkltpns

Sequence, based on observed residues (ATOM records): (download)

>d5fyfb_ a.104.1.0 (B:) automated matches {Marinobacter hydrocarbonoclasticus [TaxId: 2743]}
fvetpipdvntlaledidvsnpflyrqgqwrayfkrlrdeapvhyqknspfgpfwsvtrf
edilfvdkshdlfsaepqiilgdppvemfiamdppkhdvqrssvqgvvapknlkemegli
rsrtgdvldslptdkpfnwvpavskeltgrmlatlldfpyeerhklvewsdrmagaasat
ggefadenamfddaadmarsfsrlwrdkearraageepgfdlisllqsnketkdlinrpm
efignltllivggndttrnsmsgglvamnefprefeklkakpelipnmvseiirwqtpla
ymrriakqdvelggqtirvvmwyasgnrderkfdnpdqfiidrkdarnhmsfgygvhrcm
gnrlaelqlrilweeilkrfdnievveepervqsnfvrgysrlmvkltpns

SCOPe Domain Coordinates for d5fyfb_:

Click to download the PDB-style file with coordinates for d5fyfb_.
(The format of our PDB-style files is described here.)

Timeline for d5fyfb_:

  • d5fyfb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19