Lineage for d5lnwc_ (5lnw C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414536Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2414537Protein automated matches [190292] (35 species)
    not a true protein
  7. 2414765Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323630] (8 PDB entries)
  8. 2414784Domain d5lnwc_: 5lnw C: [328590]
    automated match to d3fema_
    complexed with gol, hg3, k8p, rp5

Details for d5lnwc_

PDB Entry: 5lnw (more details), 1.9 Å

PDB Description: crystal structure of arabidopsis thaliana pdx1-i320-g3p complex
PDB Compounds: (C:) Pyridoxal 5'-phosphate synthase subunit PDX1.3

SCOPe Domain Sequences for d5lnwc_:

Sequence, based on SEQRES records: (download)

>d5lnwc_ c.1.2.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
arraraivqavthysdpemlvevscglgea

Sequence, based on observed residues (ATOM records): (download)

>d5lnwc_ c.1.2.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifparra
raivqavthysdpemlvevscglgea

SCOPe Domain Coordinates for d5lnwc_:

Click to download the PDB-style file with coordinates for d5lnwc_.
(The format of our PDB-style files is described here.)

Timeline for d5lnwc_: