SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lnwc_ (5lnw C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (32 species)
    not a true protein
  7. 2280329Species Arabidopsis thaliana [TaxId:3702] [323630] (8 PDB entries)
  8. 2285289Domain d5lnwc_: 5lnw C: [328590]
    automated match to d3fema_
    complexed with gol, hg3, k8p, rp5

Details for d5lnwc_

PDB Entry: 5lnw (more details), 1.9 Å

PDB Description: crystal structure of arabidopsis thaliana pdx1-i320-g3p complex
PDB Compounds: (C:) Pyridoxal 5'-phosphate synthase subunit PDX1.3

SCOPe Domain Sequences for d5lnwc_:

Sequence, based on SEQRES records: (download)

>d5lnwc_ c.1.2.0 (C:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifksgdp
arraraivqavthysdpemlvevscglgea

Sequence, based on observed residues (ATOM records): (download)

>d5lnwc_ c.1.2.0 (C:) automated matches {Arabidopsis thaliana [TaxId: 3702]}
spfsvkvglaqmlrggvimdvvnaeqariaeeagacavmalervpadiraqggvarmsdp
qmikeikqavtipvmakarighfveaqileaigidyidesevltladedhhinkhnfrip
fvcgcrnlgealrriregaamirtkgeagtgniieavrhvrsvngdirvlrnmdddevft
fakklaapydlvmqtkqlgrlpvvqfaaggvatpadaalmmqlgcdgvfvgsgifparra
raivqavthysdpemlvevscglgea

SCOPe Domain Coordinates for d5lnwc_:

Click to download the PDB-style file with coordinates for d5lnwc_.
(The format of our PDB-style files is described here.)

Timeline for d5lnwc_:

  • d5lnwc_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19