SCOPe 2.06: Domain d5gzob2: 5gzo B:304-405

Lineage for d5gzob2 (5gzo B:304-405)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317280] (5 PDB entries)

8. Domain d5gzob2: 5gzo B:304-405 [328586]
   Other proteins in same PDB: d5gzoa1, d5gzob1, d5gzod1, d5gzod2, d5gzol1, d5gzol2
   automated match to d4gsxa2

Details for d5gzob2

PDB Entry: 5gzo, 2.76 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein

PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5gzob2:

Sequence; same for both SEQRES and ATOM records:

>d5gzob2 b.1.18.0 (B:304-405) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgs

Timeline for d5gzob2:

• d5gzob2 is new in SCOPe 2.06-stable
  
• d5gzob2 appears in SCOPe 2.07
  
• d5gzob2 appears in the current release, SCOPe 2.08