Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (55 species) not a true protein |
Species Zika virus [TaxId:64320] [317280] (5 PDB entries) |
Domain d5gzob2: 5gzo B:304-405 [328586] Other proteins in same PDB: d5gzoa1, d5gzob1, d5gzod1, d5gzod2, d5gzol1, d5gzol2 automated match to d4gsxa2 |
PDB Entry: 5gzo (more details), 2.76 Å
SCOPe Domain Sequences for d5gzob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gzob2 b.1.18.0 (B:304-405) automated matches {Zika virus [TaxId: 64320]} syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp vitestenskmmleldppfgdsyivigvgekkithhwhrsgs
Timeline for d5gzob2: