Lineage for d5gzob2 (5gzo B:304-405)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (54 species)
    not a true protein
  7. 2273979Species Zika virus [TaxId:64320] [317280] (5 PDB entries)
  8. 2285285Domain d5gzob2: 5gzo B:304-405 [328586]
    Other proteins in same PDB: d5gzoa1, d5gzob1, d5gzod1, d5gzod2, d5gzol1, d5gzol2
    automated match to d4gsxa2

Details for d5gzob2

PDB Entry: 5gzo (more details), 2.76 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5gzob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzob2 b.1.18.0 (B:304-405) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgs

SCOPe Domain Coordinates for d5gzob2:

Click to download the PDB-style file with coordinates for d5gzob2.
(The format of our PDB-style files is described here.)

Timeline for d5gzob2:

  • d5gzob2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19