Lineage for d5gzob1 (5gzo B:1-303)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576629Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2576630Protein automated matches [227047] (6 species)
    not a true protein
  7. 2576649Species Zika virus [TaxId:64320] [317278] (5 PDB entries)
  8. 2576655Domain d5gzob1: 5gzo B:1-303 [328585]
    Other proteins in same PDB: d5gzoa2, d5gzob2, d5gzod1, d5gzod2, d5gzol1, d5gzol2
    automated match to d4gsxa1

Details for d5gzob1

PDB Entry: 5gzo (more details), 2.76 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5gzob1:

Sequence, based on SEQRES records: (download)

>d5gzob1 f.10.1.0 (B:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
kgv

Sequence, based on observed residues (ATOM records): (download)

>d5gzob1 f.10.1.0 (B:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsenrakveitpnspraeatlggfgslgldceprtg
ldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdahakrqtv
vvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgv

SCOPe Domain Coordinates for d5gzob1:

Click to download the PDB-style file with coordinates for d5gzob1.
(The format of our PDB-style files is described here.)

Timeline for d5gzob1: