Lineage for d5ldqc_ (5ldq C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199220Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2199221Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2199283Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2199284Protein automated matches [190796] (6 species)
    not a true protein
  7. 2199290Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries)
  8. 2199293Domain d5ldqc_: 5ldq C: [328582]
    automated match to d4qakb_
    complexed with 1pe, cl, nap, po4

Details for d5ldqc_

PDB Entry: 5ldq (more details), 1.7 Å

PDB Description: crystal structure of e.coli ligt complexed with nadp+
PDB Compounds: (C:) RNA 2',3'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5ldqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldqc_ d.61.1.0 (C:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrp
fhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

SCOPe Domain Coordinates for d5ldqc_:

Click to download the PDB-style file with coordinates for d5ldqc_.
(The format of our PDB-style files is described here.)

Timeline for d5ldqc_: