SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hlmd_ (5hlm D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063930Protein automated matches [190191] (2 species)
    not a true protein
  7. 2063931Species Chicken (Gallus gallus) [TaxId:9031] [186931] (27 PDB entries)
  8. 2285279Domain d5hlmd_: 5hlm D: [328580]
    automated match to d4i60a_
    complexed with b9f, nag

Details for d5hlmd_

PDB Entry: 5hlm (more details), 2.5 Å

PDB Description: crystal structure of avidin complex with a ferrocene biotin derivative
PDB Compounds: (D:) Avidin

SCOPe Domain Sequences for d5hlmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hlmd_ b.61.1.1 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

SCOPe Domain Coordinates for d5hlmd_:

Click to download the PDB-style file with coordinates for d5hlmd_.
(The format of our PDB-style files is described here.)

Timeline for d5hlmd_:

  • d5hlmd_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19