Lineage for d1aqxc2 (1aqx C:2-76)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123401Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)
  8. 123449Domain d1aqxc2: 1aqx C:2-76 [32858]
    Other proteins in same PDB: d1aqxa1, d1aqxb1, d1aqxc1, d1aqxd1

Details for d1aqxc2

PDB Entry: 1aqx (more details), 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex
PDB Compounds: (C:)

SCOP Domain Sequences for d1aqxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqxc2 c.47.1.5 (C:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d1aqxc2:

Click to download the PDB-style file with coordinates for d1aqxc2.
(The format of our PDB-style files is described here.)

Timeline for d1aqxc2: