SCOP 1.55: Domain d1aqxc2: 1aqx C:2-76

Lineage for d1aqxc2 (1aqx C:2-76)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (30 PDB entries)

8. Domain d1aqxc2: 1aqx C:2-76 [32858]
   Other proteins in same PDB: d1aqxa1, d1aqxb1, d1aqxc1, d1aqxd1

Details for d1aqxc2

PDB Entry: 1aqx, 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex

SCOP Domain Sequences for d1aqxc2:

Sequence; same for both SEQRES and ATOM records:

>d1aqxc2 c.47.1.5 (C:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d1aqxc2:

• d1aqxc2 appears in SCOP 1.57
  
• d1aqxc2 appears in the current release, SCOPe 2.08