SCOPe 2.08: Domain d5ldqb_: 5ldq B:

Lineage for d5ldqb_ (5ldq B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.0: automated matches [191492] (1 protein)
   not a true family

6. Protein automated matches [190796] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries)

8. Domain d5ldqb_: 5ldq B: [328575]
   automated match to d4qakb_
   complexed with 1pe, cl, nap, po4

Details for d5ldqb_

PDB Entry: 5ldq, 1.7 Å

PDB Description: crystal structure of e.coli ligt complexed with nadp+

PDB Compounds: (B:) RNA 2',3'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5ldqb_:

Sequence, based on SEQRES records:

>d5ldqb_ d.61.1.0 (B:) automated matches {Escherichia coli [TaxId: 469008]}
epqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekalsl
lagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrpf
hphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Sequence, based on observed residues (ATOM records):

>d5ldqb_ d.61.1.0 (B:) automated matches {Escherichia coli [TaxId: 469008]}
epqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekalsl
lagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsnrpfhphit
llrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Timeline for d5ldqb_:

• d5ldqb_ first appeared in SCOPe 2.06
  
• d5ldqb_ appears in SCOPe 2.07