Lineage for d5hlma_ (5hlm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063930Protein automated matches [190191] (2 species)
    not a true protein
  7. 2063931Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2285272Domain d5hlma_: 5hlm A: [328573]
    automated match to d4i60a_
    complexed with b9f, nag

Details for d5hlma_

PDB Entry: 5hlm (more details), 2.5 Å

PDB Description: crystal structure of avidin complex with a ferrocene biotin derivative
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d5hlma_:

Sequence, based on SEQRES records: (download)

>d5hlma_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyitavtatsneikesplhgtqntinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Sequence, based on observed residues (ATOM records): (download)

>d5hlma_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyitavtneikesplhgtqnttqptfgftvn
wkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl

SCOPe Domain Coordinates for d5hlma_:

Click to download the PDB-style file with coordinates for d5hlma_.
(The format of our PDB-style files is described here.)

Timeline for d5hlma_:

  • d5hlma_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19