SCOPe 2.06: Domain d1aqxb2: 1aqx B:2-76

Lineage for d1aqxb2 (1aqx B:2-76)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries)

8. Domain d1aqxb2: 1aqx B:2-76 [32857]
   Other proteins in same PDB: d1aqxa1, d1aqxb1, d1aqxc1, d1aqxd1
   complexed with gtd, mes

Details for d1aqxb2

PDB Entry: 1aqx, 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1aqxb2:

Sequence; same for both SEQRES and ATOM records:

>d1aqxb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d1aqxb2:

• d1aqxb2 first appeared (with stable ids) in SCOP 1.55
  
• d1aqxb2 appears in SCOPe 2.05
  
• d1aqxb2 appears in SCOPe 2.07
  
• d1aqxb2 appears in the current release, SCOPe 2.08