Lineage for d1aqxb2 (1aqx B:2-76)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181085Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries)
  8. 181138Domain d1aqxb2: 1aqx B:2-76 [32857]
    Other proteins in same PDB: d1aqxa1, d1aqxb1, d1aqxc1, d1aqxd1

Details for d1aqxb2

PDB Entry: 1aqx (more details), 2 Å

PDB Description: glutathione s-transferase in complex with meisenheimer complex

SCOP Domain Sequences for d1aqxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqxb2 c.47.1.5 (B:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d1aqxb2:

Click to download the PDB-style file with coordinates for d1aqxb2.
(The format of our PDB-style files is described here.)

Timeline for d1aqxb2: