SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ldod_ (5ldo D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2178385Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2178386Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2178448Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2178449Protein automated matches [190796] (5 species)
    not a true protein
  7. 2285265Species Escherichia coli [TaxId:469008] [328566] (7 PDB entries)
  8. 2285266Domain d5ldod_: 5ldo D: [328567]
    automated match to d4qakb_
    complexed with 3am

Details for d5ldod_

PDB Entry: 5ldo (more details), 2.75 Å

PDB Description: crystal structure of e.coli ligt complexed with 3'-amp
PDB Compounds: (D:) RNA 2',3'-cyclic phosphodiesterase

SCOPe Domain Sequences for d5ldod_:

Sequence, based on SEQRES records: (download)

>d5ldod_ d.61.1.0 (D:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgcfqsnrp
fhphitllrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

Sequence, based on observed residues (ATOM records): (download)

>d5ldod_ d.61.1.0 (D:) automated matches {Escherichia coli [TaxId: 469008]}
sepqrlffaidlpaeireqiihwrakhfppeagrpvaadnlhltlaflgevsaekekals
llagrirqpgftltlddagqwlrsrvvwlgmrqpprgliqlanmlrsqaarsgfhphitl
lrdaseavtipppgfnwsyavteftlyassfargrtrytplkrwaltq

SCOPe Domain Coordinates for d5ldod_:

Click to download the PDB-style file with coordinates for d5ldod_.
(The format of our PDB-style files is described here.)

Timeline for d5ldod_:

  • d5ldod_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19