Lineage for d5igaa1 (5iga A:25-342)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2285237Species Uncultured bacterium [TaxId:77133] [328538] (2 PDB entries)
  8. 2285257Domain d5igaa1: 5iga A:25-342 [328558]
    Other proteins in same PDB: d5igaa2
    automated match to d5im2a_
    complexed with peg, phb, trs; mutant

Details for d5igaa1

PDB Entry: 5iga (more details), 1.45 Å

PDB Description: crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with co-purified parahydroxybenzoate
PDB Compounds: (A:) trap transporter solute binding protein

SCOPe Domain Sequences for d5igaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5igaa1 c.94.1.0 (A:25-342) automated matches {Uncultured bacterium [TaxId: 77133]}
evvlkfhsfppmpansnakfvkpwsekvlaesngeikveiypamqlggkppqlvdqvrdg
vvdivwtvagytpgrfphleafelpfmpasaeatsqalqeyvdtvaasdlkdykvlavfc
hapgkihtkekviasaadlngmkmrgptrvitkmleglgatpvgmpvpavagalskgvid
gmvvpweimpsfklheltaahttvsgsrglyttpflflmnkakyeslsdehkkvidnnag
lalaklagqlwdgfevparklaldaggtihslsggplaemkaagegleadwiksandrgl
dgamlvktakdliskydk

SCOPe Domain Coordinates for d5igaa1:

Click to download the PDB-style file with coordinates for d5igaa1.
(The format of our PDB-style files is described here.)

Timeline for d5igaa1:

  • d5igaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19

View in 3D
Domains from same chain:
(mouse over for more information)
d5igaa2