Lineage for d5hm6a_ (5hm6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2115095Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2115096Protein automated matches [190131] (71 species)
    not a true protein
  7. 2115097Species Acinetobacter baumannii [TaxId:470] [328556] (3 PDB entries)
  8. 2115100Domain d5hm6a_: 5hm6 A: [328557]
    automated match to d5dcla_

Details for d5hm6a_

PDB Entry: 5hm6 (more details), 2 Å

PDB Description: n-terminal domain of bfmr from acinetobacter baumannii
PDB Compounds: (A:) BfmR

SCOPe Domain Sequences for d5hm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hm6a_ c.23.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
klpkilivedderlarltqeylirnglevgvetdgnrairriiseqpdlvvldvmlpgad
gltvcrevrphyhqpilmltartedmdqvlglemgaddyvakpvqprvllarirallrr

SCOPe Domain Coordinates for d5hm6a_:

Click to download the PDB-style file with coordinates for d5hm6a_.
(The format of our PDB-style files is described here.)

Timeline for d5hm6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5hm6b_