Lineage for d5i7ia_ (5i7i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916382Species Uncultured marine [TaxId:56765] [328526] (2 PDB entries)
  8. 2916383Domain d5i7ia_: 5i7i A: [328548]
    Other proteins in same PDB: d5i7ib2
    automated match to d5im2a_
    complexed with 3hb, peg

Details for d5i7ia_

PDB Entry: 5i7i (more details), 1.3 Å

PDB Description: crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-crystallized 3-hydroxybenzoate
PDB Compounds: (A:) TRAP solute Binding Protein

SCOPe Domain Sequences for d5i7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i7ia_ c.94.1.0 (A:) automated matches {Uncultured marine [TaxId: 56765]}
evvlkfhsfppmpansnakfvkpwsekvlaesngeikveiypamqlggkppqlvdqvrdg
vvdivwtvagytpgrfphleafelpfmpasaeatsqalqeyvdtvaasdlkdykvlavfc
hapgkihtkekviksaadlngmkmrgptrvitkmleglgatpvgmpvpavagalskgvid
gmvvpweimpsfklheltkahttvsgsrglyttpflflmnkakyeslsdehkkvidnnag
lalaklagqlwdgfevparklaldaggtihslsggplaemkaageglekdwiksandrgl
dgamlvktakdliskydk

SCOPe Domain Coordinates for d5i7ia_:

Click to download the PDB-style file with coordinates for d5i7ia_.
(The format of our PDB-style files is described here.)

Timeline for d5i7ia_: