Lineage for d5hjye1 (5hjy E:1-138)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175463Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2175464Protein automated matches [226983] (18 species)
    not a true protein
  7. 2284487Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)
  8. 2285241Domain d5hjye1: 5hjy E:1-138 [328542]
    Other proteins in same PDB: d5hjya2, d5hjyb2, d5hjyc2, d5hjyd2, d5hjye2, d5hjyf2
    automated match to d4lf2a1
    complexed with cap, cl, mg; mutant

Details for d5hjye1

PDB Entry: 5hjy (more details), 2.3 Å

PDB Description: structure function studies of r. palustris rubisco (i165t mutant; cabp-bound)
PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hjye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hjye1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5hjye1:

Click to download the PDB-style file with coordinates for d5hjye1.
(The format of our PDB-style files is described here.)

Timeline for d5hjye1:

  • d5hjye1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19