Lineage for d5izza_ (5izz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (137 species)
    not a true protein
  7. 2285237Species Uncultured bacterium [TaxId:77133] [328538] (2 PDB entries)
  8. 2285238Domain d5izza_: 5izz A: [328539]
    automated match to d5im2a_
    complexed with 3hp, peg; mutant

Details for d5izza_

PDB Entry: 5izz (more details), 1.6 Å

PDB Description: crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand
PDB Compounds: (A:) trap transporter solute binding protein

SCOPe Domain Sequences for d5izza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5izza_ c.94.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
evvlkfhsfppmpansnakfvkpwsekvlaesngeikveiypamqlggkppqlvdqvrdg
vvdivwtvagytpgrfphleafelpfmpasaeatsqalqeyvdtvaasdlkdykvlavfc
hapgkihtkekviasaadlngmkmrgptrvitkmleglgatpvgmpvpavagalskgvid
gmvvpweimpsfklheltaahttvsgsrglyttpflflmnkakyeslsdehkkvidnnag
lalaklagqlwdgfevparklaldaggtihslsggplaemkaagegleadwiksandrgl
dgamlvktakdliskydk

SCOPe Domain Coordinates for d5izza_:

Click to download the PDB-style file with coordinates for d5izza_.
(The format of our PDB-style files is described here.)

Timeline for d5izza_:

  • d5izza_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19