Lineage for d5hh4d_ (5hh4 D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2205699Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2205700Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2205701Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 protein domains)
  6. 2205847Protein automated matches [190079] (9 species)
    not a true protein
  7. 2205927Species Serratia marcescens [TaxId:615] [186800] (5 PDB entries)
  8. 2285228Domain d5hh4d_: 5hh4 D: [328529]
    Other proteins in same PDB: d5hh4b2
    automated match to d1jjeb_
    complexed with 60m, cl, edo, zn

Details for d5hh4d_

PDB Entry: 5hh4 (more details), 2 Å

PDB Description: crystal structure of metallo-beta-lactamase imp-1 in complex with a phosphonate-based inhibitor
PDB Compounds: (D:) beta-lactamase imp-1

SCOPe Domain Sequences for d5hh4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hh4d_ d.157.1.1 (D:) automated matches {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglne

SCOPe Domain Coordinates for d5hh4d_:

Click to download the PDB-style file with coordinates for d5hh4d_.
(The format of our PDB-style files is described here.)

Timeline for d5hh4d_:

  • d5hh4d_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19