SCOPe 2.06: Domain d5i5pa1: 5i5p A:25-342

Lineage for d5i5pa1 (5i5p A:25-342)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Uncultured marine [TaxId:56765] [328526] (2 PDB entries)

8. Domain d5i5pa1: 5i5p A:25-342 [328527]
   Other proteins in same PDB: d5i5pa2, d5i5pb2
   automated match to d5im2a_
   complexed with br, peg, phb

Details for d5i5pa1

PDB Entry: 5i5p, 1.6 Å

PDB Description: crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-purified 4-hydroxybenzoate

PDB Compounds: (A:) trap transporter solute binding protein

SCOPe Domain Sequences for d5i5pa1:

Sequence; same for both SEQRES and ATOM records:

>d5i5pa1 c.94.1.0 (A:25-342) automated matches {Uncultured marine [TaxId: 56765]}
evvlkfhsfppmpansnakfvkpwsekvlaesngeikveiypamqlggkppqlvdqvrdg
vvdivwtvagytpgrfphleafelpfmpasaeatsqalqeyvdtvaasdlkdykvlavfc
hapgkihtkekviksaadlngmkmrgptrvitkmleglgatpvgmpvpavagalskgvid
gmvvpweimpsfklheltkahttvsgsrglyttpflflmnkakyeslsdehkkvidnnag
lalaklagqlwdgfevparklaldaggtihslsggplaemkaageglekdwiksandrgl
dgamlvktakdliskydk

Timeline for d5i5pa1:

• d5i5pa1 is new in SCOPe 2.06-stable
  
• d5i5pa1 appears in SCOPe 2.07
  
• d5i5pa1 appears in the current release, SCOPe 2.08