Lineage for d12gsa2 (12gs A:2-76)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181085Species Human (Homo sapiens), class pi [TaxId:9606] [52864] (33 PDB entries)
  8. 181135Domain d12gsa2: 12gs A:2-76 [32852]
    Other proteins in same PDB: d12gsa1, d12gsb1

Details for d12gsa2

PDB Entry: 12gs (more details), 2.1 Å

PDB Description: glutathione s-transferase complexed with s-nonyl-glutathione

SCOP Domain Sequences for d12gsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d12gsa2 c.47.1.5 (A:2-76) Glutathione S-transferase {Human (Homo sapiens), class pi}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

SCOP Domain Coordinates for d12gsa2:

Click to download the PDB-style file with coordinates for d12gsa2.
(The format of our PDB-style files is described here.)

Timeline for d12gsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d12gsa1