SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h9uc1 (5h9u C:1-118)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2193346Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2193347Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2193452Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2193453Protein automated matches [254617] (10 species)
    not a true protein
  7. 2285161Species Thermus thermophilus [TaxId:262724] [328462] (1 PDB entry)
  8. 2285218Domain d5h9uc1: 5h9u C:1-118 [328519]
    automated match to d4odja1

Details for d5h9uc1

PDB Entry: 5h9u (more details), 2.67 Å

PDB Description: crystal structure of a thermostable methionine adenosyltransferase
PDB Compounds: (C:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d5h9uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h9uc1 d.130.1.0 (C:1-118) automated matches {Thermus thermophilus [TaxId: 262724]}
mralrlvtsesvteghpdkladrisdaildaliaqdkkarvaaetlvttglvfvageitt
egyvdipnlvrktvrevgytrakygfdadtcavltaideqspdiaggvnlsyewrvlk

SCOPe Domain Coordinates for d5h9uc1:

Click to download the PDB-style file with coordinates for d5h9uc1.
(The format of our PDB-style files is described here.)

Timeline for d5h9uc1:

  • d5h9uc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-19