Lineage for d5dyyb_ (5dyy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (89 species)
    not a true protein
  7. 2136259Species Human (Homo sapiens) [TaxId:9606] [188340] (70 PDB entries)
  8. 2285211Domain d5dyyb_: 5dyy B: [328512]
    automated match to d3zv7a_
    complexed with 5hh, cl, edo, fuc, ful, gol, nag

Details for d5dyyb_

PDB Entry: 5dyy (more details), 2.65 Å

PDB Description: crystal structure of human butyrylcholinesterase in complex with n- ((1-benzylpiperidin-3-yl)methyl)naphthalene-2-sulfonamide
PDB Compounds: (B:) cholinesterase

SCOPe Domain Sequences for d5dyyb_:

Sequence, based on SEQRES records: (download)

>d5dyyb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
qnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

Sequence, based on observed residues (ATOM records): (download)

>d5dyyb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
nnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

SCOPe Domain Coordinates for d5dyyb_:

Click to download the PDB-style file with coordinates for d5dyyb_.
(The format of our PDB-style files is described here.)

Timeline for d5dyyb_:

  • d5dyyb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19