SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5dyyb_ (5dyy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (79 species)
    not a true protein
  7. 2136259Species Human (Homo sapiens) [TaxId:9606] [188340] (66 PDB entries)
  8. 2285211Domain d5dyyb_: 5dyy B: [328512]
    automated match to d3zv7a_
    complexed with 5hh, cl, edo, fuc, ful, gol, nag

Details for d5dyyb_

PDB Entry: 5dyy (more details), 2.65 Å

PDB Description: crystal structure of human butyrylcholinesterase in complex with n- ((1-benzylpiperidin-3-yl)methyl)naphthalene-2-sulfonamide
PDB Compounds: (B:) cholinesterase

SCOPe Domain Sequences for d5dyyb_:

Sequence, based on SEQRES records: (download)

>d5dyyb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
qnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

Sequence, based on observed residues (ATOM records): (download)

>d5dyyb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
nnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

SCOPe Domain Coordinates for d5dyyb_:

Click to download the PDB-style file with coordinates for d5dyyb_.
(The format of our PDB-style files is described here.)

Timeline for d5dyyb_:

  • d5dyyb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19