SCOPe 2.08: Domain d5ckna1: 5ckn A:1-119

Lineage for d5ckna1 (5ckn A:1-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families)
   automatically mapped to Pfam PF00431

5. Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)

6. Protein automated matches [328442] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [328443] (3 PDB entries)

8. Domain d5ckna1: 5ckn A:1-119 [328509]
   Other proteins in same PDB: d5ckna2, d5cknd2
   automated match to d1nt0a1
   complexed with ca

Details for d5ckna1

PDB Entry: 5ckn, 2.6 Å

PDB Description: the cub1-egf-cub2 domains of rat mbl-associated serine protease-2 (masp-2) bound to ca2+

PDB Compounds: (A:) Mannan-binding lectin serine peptidase 2

SCOPe Domain Sequences for d5ckna1:

Sequence; same for both SEQRES and ATOM records:

>d5ckna1 b.23.1.1 (A:1-119) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
skwpepvfgrlvspgfpekygnhqdrswtltappgfrlrlyfthfnlelsyrceydfvkl
tsgtkvlatlcgqestdterapgndtfyslgpslkvtfhsdysnekpftgfeafyaaed

Timeline for d5ckna1:

• d5ckna1 first appeared in SCOPe 2.06
  
• d5ckna1 appears in SCOPe 2.07