Lineage for d5h1yb_ (5h1y B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (127 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (123 PDB entries)
  8. 2285193Domain d5h1yb_: 5h1y B: [328494]
    automated match to d4a4da_
    protein/DNA complex; complexed with mg, so4

Details for d5h1yb_

PDB Entry: 5h1y (more details), 2.26 Å

PDB Description: crystal structure of the ddx41 dead domain in complex with so42- and mg2+
PDB Compounds: (B:) Probable ATP-dependent RNA helicase DDX41

SCOPe Domain Sequences for d5h1yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h1yb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smseerhervrkkyhilvegdgipppiksfkemkfpaailrglkkkgihhptpiqiqgip
tilsgrdmigiaftgsgktlvftlpvimfcleqekrlpfskregpygliicpsrelarqt
hgileyycrllqedsspllrcalciggmsvkeqmetirhgvhmmvatpgrlmdllqkkmv
sldicrylaldeadrmidmgfegdirtifsyfkgqrqtllfsatmpkkiqnfaksalvkp
vtinv

SCOPe Domain Coordinates for d5h1yb_:

Click to download the PDB-style file with coordinates for d5h1yb_.
(The format of our PDB-style files is described here.)

Timeline for d5h1yb_:

  • d5h1yb_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18