Lineage for d5h3ab_ (5h3a B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2536167Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2536168Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2536169Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 protein domains)
  6. 2536512Protein automated matches [190469] (15 species)
    not a true protein
  7. 2536590Species Human herpesvirus 8 [TaxId:37296] [328471] (3 PDB entries)
  8. 2536596Domain d5h3ab_: 5h3a B: [328493]
    automated match to d1hvya_
    complexed with d16, ump

Details for d5h3ab_

PDB Entry: 5h3a (more details), 2.4 Å

PDB Description: structural analysis of kshv thymidylate synthase
PDB Compounds: (B:) orf70

SCOPe Domain Sequences for d5h3ab_:

Sequence, based on SEQRES records: (download)

>d5h3ab_ d.117.1.1 (B:) automated matches {Human herpesvirus 8 [TaxId: 37296]}
pheelqylrqlreilcrgsdrldrtgigtlslfgmqaryslrdhfpllttkrvfwrgvvq
ellwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaay
vdadadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadg
elscqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplr
lqltrtprpfprleilrsvssmeeftpddfrlvdycphptirm

Sequence, based on observed residues (ATOM records): (download)

>d5h3ab_ d.117.1.1 (B:) automated matches {Human herpesvirus 8 [TaxId: 37296]}
pheelqylrqlreilcrgsdrltgigtlslfgmqaryslrdhfpllttkrvfwrgvvqel
lwflkgstdsrelsrtgvkiwdkngsreflagrglahrregdlgpvygfqwrhfgaayvd
adadytgqgfdqlsyivdliknnphdrriimcawnpadlslmalppchllcqfyvadgel
scqlyqrsgdmglgvpfniasyslltymlahvtglrpgefihtlgdahiykthieplrlq
ltrtprpfprleilrsvssmeeftpddfrlvdycphptirm

SCOPe Domain Coordinates for d5h3ab_:

Click to download the PDB-style file with coordinates for d5h3ab_.
(The format of our PDB-style files is described here.)

Timeline for d5h3ab_: