SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f0wc_ (5f0w C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176148Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2176149Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 protein domains)
  6. 2176150Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 2176169Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (15 PDB entries)
    Uniprot O00244
  8. 2285185Domain d5f0wc_: 5f0w C: [328486]
    automated match to d1fe0b_
    complexed with ag

Details for d5f0wc_

PDB Entry: 5f0w (more details), 2.7 Å

PDB Description: crystal structure of human copper homeostatic proteins atox1
PDB Compounds: (C:) copper transport protein atox1

SCOPe Domain Sequences for d5f0wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f0wc_ d.58.17.1 (C:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle

SCOPe Domain Coordinates for d5f0wc_:

Click to download the PDB-style file with coordinates for d5f0wc_.
(The format of our PDB-style files is described here.)

Timeline for d5f0wc_:

  • d5f0wc_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18