Lineage for d5hf0x_ (5hf0 X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2136851Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)
  7. 2136984Species Staphylococcus aureus [TaxId:1280] [188976] (25 PDB entries)
  8. 2285180Domain d5hf0x_: 5hf0 X: [328481]
    automated match to d3sqyx_
    complexed with gol, nap, u06, xnp

Details for d5hf0x_

PDB Entry: 5hf0 (more details), 2.25 Å

PDB Description: staphylococcus aureus dihydrofolate reductase complexed with beta- nadph, cyclic alpha-nadph anomer and 3'-(3-(2,4-diamino-6- ethylpyrimidin-5-yl)prop-2-yn-1-yl)-4'-methoxy-[1,1'-biphenyl]-4- carboxylic acid (ucp1106)
PDB Compounds: (X:) dihydrofolate reductase

SCOPe Domain Sequences for d5hf0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hf0x_ c.71.1.1 (X:) Dihydrofolate reductase, prokaryotic type {Staphylococcus aureus [TaxId: 1280]}
tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
tffppytfedwevassvegkldekntiphtflhlirk

SCOPe Domain Coordinates for d5hf0x_:

Click to download the PDB-style file with coordinates for d5hf0x_.
(The format of our PDB-style files is described here.)

Timeline for d5hf0x_:

  • d5hf0x_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-18