Lineage for d5hfob1 (5hfo B:23-265)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2218920Species Escherichia coli [TaxId:562] [225496] (14 PDB entries)
  8. 2285178Domain d5hfob1: 5hfo B:23-265 [328479]
    Other proteins in same PDB: d5hfoa2, d5hfob2
    automated match to d4s2na_
    complexed with cl, gol, so4

Details for d5hfob1

PDB Entry: 5hfo (more details), 2.21 Å

PDB Description: crystal structure of oxa-232 beta-lactamase
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5hfob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hfob1 e.3.1.0 (B:23-265) automated matches {Escherichia coli [TaxId: 562]}
kewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsliald
lgvvkdehqvfkwdgqtrdiaawnrdhdlitamkysvvpvyqefarqigearmskmlhaf
dygnedisgnvdsfwldggirisatqqiaflrklyhnklhvsersqrivkqamlteangd
yiiraktgystsiepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqek
iip

SCOPe Domain Coordinates for d5hfob1:

Click to download the PDB-style file with coordinates for d5hfob1.
(The format of our PDB-style files is described here.)

Timeline for d5hfob1:

  • d5hfob1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-18

View in 3D
Domains from same chain:
(mouse over for more information)
d5hfob2