SCOPe 2.08: Domain d5hfob1: 5hfo B:23-265

Lineage for d5hfob1 (5hfo B:23-265)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [225496] (22 PDB entries)

8. Domain d5hfob1: 5hfo B:23-265 [328479]
   Other proteins in same PDB: d5hfoa2, d5hfob2
   automated match to d4s2na_
   complexed with cl, gol, so4

Details for d5hfob1

PDB Entry: 5hfo, 2.21 Å

PDB Description: crystal structure of oxa-232 beta-lactamase

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5hfob1:

Sequence; same for both SEQRES and ATOM records:

>d5hfob1 e.3.1.0 (B:23-265) automated matches {Escherichia coli [TaxId: 562]}
kewqenkswnahftehksqgvvvlwnenkqqgftnnlkranqaflpastfkipnsliald
lgvvkdehqvfkwdgqtrdiaawnrdhdlitamkysvvpvyqefarqigearmskmlhaf
dygnedisgnvdsfwldggirisatqqiaflrklyhnklhvsersqrivkqamlteangd
yiiraktgystsiepkigwwvgwvelddnvwffamnmdmptsdglglrqaitkevlkqek
iip

Timeline for d5hfob1:

• d5hfob1 first appeared in SCOPe 2.06
  
• d5hfob1 appears in SCOPe 2.07